General Information

  • ID:  hor003856
  • Uniprot ID:  Q9YGK5
  • Protein name:  Beta-endorphin
  • Gene name:  pomcb
  • Organism:  Cyprinus carpio (Common carp)
  • Family:  POMC family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Cyprinus (genus), Cyprininae (subfamily), Cyprinidae (family), Cyprinoidei (suborder), Cypriniformes (order), Cypriniphysae (superorder), Otophysi, Ostariophysi (subcohort), Otomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  YGGFMKSWDERSQKPLLTLFKNVINKEHQKKDQ
  • Length:  33
  • Propeptide:  MVRGVRMLCPAWLLALAVLCAGGSEVRAQCWEDARCRDLTTDENILNCIQLCRSDLTDETPVYPGESHLQPPSELEQAEVLEPLSPAALAPAEQMDPESSPRHELKRSYSMEHFRWGKPVGRKRRPIKVYTNGVEEESAESLPAEMRRELATNEVNHPQEDSALIQQKKKDGSYKMKHFRWSSPPAGKRYGGFMKSWDERSQKPLLTLFKNVINKEHQKKDQ
  • Signal peptide:  MVRGVRMLCPAWLLALAVLCAGGSEVRA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Endogenous orexigenic opiate.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9YGK5-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003856_AF2.pdbhor003856_ESM.pdb

Physical Information

Mass: 456554 Formula: C180H282N50O51S
Absent amino acids: AC Common amino acids: K
pI: 10.29 Basic residues: 8
Polar residues: 8 Hydrophobic residues: 8
Hydrophobicity: -126.97 Boman Index: -8711
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 56.06
Instability Index: 2806.67 Extinction Coefficient cystines: 6990
Absorbance 280nm: 218.44

Literature

  • PubMed ID:  9806347
  • Title:  Cloning and expression of two proopiomelanocortin mRNAs in the common carp (Cyprinus carpio L.).